Analyse des Metatranskriptoms in Biogasanlagen

Biogasanlage © Martina Nolte, Lizenz: Creative Commons CC-by-sa-3.0 de

Biogas ist ein energiereiches Gas, das überwiegend aus Methan besteht. Es kann entweder direkt in Blockheizkraftwerken verstromt oder nach einer Aufbereitung ins Erdgasnetz eingespeist werden. Da die Biogasproduktion nicht von saisonalen oder meteorologischen Bedingungen abhängig ist und Methan zudem lagerfähig ist, trägt es zur Grundlast im Energienetz bei.
Um eine möglichst effiziente Nutzung der eingesetzten Rohstoffe zu ermöglichen und damit den Biogasertrag zu maximieren, ist ein stabiler Betrieb wichtig. Der mehrstufige mikrobiologische Abbauprozess ist anfällig für Störungen, da die am Abbauprozess beteiligten Mikroorganismen sehr sensibel sind. Der Überwachung des Gärprozesses kommt daher eine besondere Bedeutung zu. Chemische Parameter wie der pH-Wert oder die Konzentration an Gärsäuren sind immer eine Folge einer Störung der Mikrobiologie und können nur einen zeitverzögerten Zustand anzeigen.
Die Erforschung der Mikroorganismen im Fermenter erscheint demnach als ein guter Ansatz, um die Biozönose zu verstehen und damit einen stabilen Betrieb von Beginn an zu gewährleisten. Mit den Vorteilen der Next-Generation-Sequenzierungstechnologien auf Basis der genregulatorischen Prozesse ein Blick auf die biochemischen Vorgänge möglich. Mikroorganismen reagieren direkt auf Veränderungen der Umgebungsbedingungen mit der Regulation der entsprechenden Gene. Diese werden als Transkriptom in der messenger RNA (mRNA) sichtbar.
Das Forschungsprojekt soll zum Verständnis der vorherrschenden Stoffwechselwege, der regulatorische Prozesse, sowie der Interaktionen zwischen den Mikroorganismen beitragen. Anhand der hochkonservierten ribosomalen RNA werden zudem Studien der Populationsdynamik möglich. In Korrelation mit chemischen und physikalisch-verfahrenstechnischen Parametern soll der Prozess als Ganzes besser verstanden und simulierbar werden, um einen stabilen und effizienten Betrieb zu gewährleisten.

Aktuelles

17. Nachwuchswissenschaftlerkonferenz an der Hochschule Schmalkalden

17. Nachwuchswissenschaftlerkonferenz an der Hochschule Schmalkalden
21.04.2016

Am Mittwoch, 20. April 2016, fand an der HS Schmalkalden die 17. Nachwuchswissenschaftlerkonferenz ostdeutscher Hochschulen statt. Teil der Mittweidaer Delegation waren die 3 Wissenschaftler Nadine Wappler, Lucy Stark und Robert...mehr lesen

Microbiology and Infection 2014

Microbiology and Infection 2014
15.10.2014

Vom 6. bis 8. Oktober war die Fachgruppe Biotechnologie auf der Konferenz „Microbiology and Infection 2014 – 4. Gemeinsamer Kongress von der Deutschen Gesellschaft für Hygiene und Mikrobiologie (DGHM) und der Vereinigung für...mehr lesen

Biotechnologen unter Nobelpreisträgern & Rittern

Biotechnologen unter Nobelpreisträgern & Rittern
19.09.2014

Vor Nobelpreisträgern und Rittern spricht man nicht alle Tage - unsere Doktorandin Lucy Stark hatte kürzlich das Vergnügen auf der internationalen Konferenz „Horizons in Molecular Biology“. Diese fand vom 15. bis 18. September...mehr lesen

International Conference on Biogas Microbiology

International Conference on Biogas Microbiology
19.06.2014

Vom 10. bis 12. Juni 2014 fand in der Universitätsstadt Uppsala in Schweden zum zweiten Mal die International Conference on Biogas Microbiology (ICBM) an der Swedish University of Agricultural Sciences (SLU) statt. Unsere...mehr lesen

Nach oben

Publikationen

Efficiency of RNA extraction from selected bacteria in the context of biogas production and metatranscriptomics
L. Stark, T. Giersch, R. Wünschiers
In: Anaerobe 29:85-90 (PDF)

Determination of the equilibration concentrations of substances during recirculation of process water in anaerobic digestion plants.
L. Stark, T. Keil, C. Herbes, R. Wünschiers
In: Honekamp & Schindler (Eds); 13. Nachwuchswissenschaftlerkonferenz mitteldeutscher Fachhochschulen; ISBN 978-3-86870-436-5; pp 293-298

Vorträge

The efficiency of isolating RNA from various bacteria using different methods
L. Stark
8th International Symposium on Anaerobic Microbiology (ISAM8)
Innsbruck,  June 12-15
 

Determination of the equilibration of substances during recirculation of process water in anaerobic digestion plants
L. Stark, T. Keil, C. Herbes, R. Wünschiers
13. Nachwuchswissenschaftler-Konferenz
Görlitz; 19th of April 2012

Poster

Untersuchung der Dynamik biochemischer Prozesse einer Biogasanlage während des Anfahrens - Eine Metatranskriptomstudie
Lucy Stark & Röbbe Wünschiers
17. Nachwuchswissenschaftlerkonferenz
Schmalkalden, Germany, April 20, 2016

Untersuchung der Dynamik der biologischen Prozesse in Biogasanlagen
Lucy Stark & Röbbe Wünschiers
24. Internationale Wissenschaftliche Konferenz Mittweida, November 19-20, 2015

Analyzing the metatranscriptome of an anaerobic digestion plant
L. Stark, R. Wünschiers
Microbiology and Infection 2014. 4. Joint Conference of the Association for General and Applied Microbiology (VAAM) and the Society of Hygiene and Microbiology (DGHM), October 05-08

Efficiency of RNA extraction from selected bacteria in the context of biogas production and metatranscriptomics (PDF)
Lucy Stark, Röbbe Wünschiers
11th Horizons in Molecular Biology
Göttingen, September 15-18

Transcriptomic Monitoring of Escherichia coli Growth (PDF)
Nadine Wappler, Eric Zuchantke, Tina Giersch, Lucy Stark, Röbbe Wünschiers
11th Horizons in Molecular Biology
Göttingen, September 15-18

Insight and pitfalls in metatranscriptomics (PDF)
L. Stark, R. Wünschiers
2nd International Conference on Biogas Microbiology Uppsala/Sweden 2014, June 10-12
Uppsala/ Schweden

Basic research for a better monitoring in anaerobic digestion (PDF)
L.Stark, T. Giersch, R. Wünschiers
Saxon Biotechnology Symposium 2014, 19th of March

Analyzing metatransciptome sequence data obtaine from a set of pooled micoorganisms (PDF)
G. Kind, L. Stark, R. Wünschiers
8th International Symposium on Anaerobic Microbiology (ISAM8)
Innsbruck 2013,  June 12-15


Analyse des Metatranskriptoms in Biogasanlagen (PDF)
L. Stark, R. Wünschiers
Wissenschaft und Wirtschaft im Dialog Mittweida 2012, 03rd of July